Recombinant Macaca mulatta (Rhesus macaque) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 (HSD3B1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HSD3B1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I; 3-beta-HSD I; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxysteroid 3-dehydrogenase; Delta-5-3-ketosteroid isomerase; Dihydrotestosterone oxidoreductase; Steroid Delta-isomerase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
HSD3B1
Target Protein Sequence
TGWSCLVTGAGGFLGQRIVRLLVEEKELKEIRVLDKAFRPELREEFSKLQNKTKLTVLEG DILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFI YTSTLEVAGPNSYKEIIQNGHEEEPLENTWPAPYPYSKKLAEKAVLAANGWTLKNGGTLY TCALRPMYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALR DPKKAPSVQGQFYYISDDTPHQSYDNLNYILSKEFGLCLDSRWSLPLALMYWIGFLLEVV SFLLSPVYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLV DRHKETLKSKTQ
Uniprot No.

Target Background

Function

This bifunctional enzyme is responsible for the oxidation and isomerization of 3β-hydroxy-Δ5-steroid precursors to 3-oxo-Δ4-steroids—a crucial step in steroid hormone biosynthesis. It specifically catalyzes the conversion of pregnenolone to progesterone, 17α-hydroxypregnenolone to 17α-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone. Furthermore, it catalyzes the interconversion between 3β-hydroxy and 3-oxo-5α-androstane steroids, regulating the bioavailability of active forms. Specifically, it converts dihydrotestosterone to its inactive form, 5α-androstanediol, which does not bind to the androgen receptor (AR). It also converts androstanedione, a precursor of testosterone and estrone, to epiandrosterone. NAD+ is the preferred electron donor for 3β-hydroxy-steroid dehydrogenase activity, while NADPH is preferred for 3-ketosteroid reductase activity.

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Adrenal glands, testes and ovaries.

Q&A

What is the basic structure and function of HSD3B1 in rhesus macaques?

HSD3B1 in Macaca mulatta is a bifunctional enzyme that catalyzes the rate-limiting step in the conversion of adrenal androgen precursors to dihydrotestosterone (DHT) and other potent androgens. The enzyme catalyzes both the 3β-hydroxysteroid dehydrogenase and Δ5→4-isomerase activities.

Structurally, the macaque HSD3B1 consists of 372 amino acids with a calculated molecular mass of approximately 41,874 Daltons (excluding the first Met) . The enzyme shows 93.9% amino acid sequence similarity with human HSD3B1 and 79.4% similarity with bovine 3β-HSD . Computer analysis of the deduced macaque 3β-HSD protein sequence predicts the presence of an NH2-terminal membrane-associated segment as well as four additional membrane-spanning segments, suggesting that HSD3B1 is an integral membrane protein .

The enzyme exhibits tissue-specific expression in macaques, with mRNA detected in classical steroidogenic tissues (ovary, testis, adrenal glands) as well as peripheral tissues including liver, kidney, and epididymis .

How does macaque HSD3B1 enzymatic activity compare across different tissues?

The activity of 3β-hydroxysteroid dehydrogenase/Δ5→4-isomerase (3β-HSDH) varies significantly across different rhesus macaque tissues. Research has shown distinct enzymatic profiles:

TissueMaximum Velocity (Vm)Michaelis-Menten Constant (Km)Estimated Dissociation Constants for Pregnenolone
Adrenal (microsomes)146 nmoles progesterone/h × mg⁻¹ protein1.8 μM2.3 μM
Placenta1.2 nmoles progesterone/h × mg⁻¹ protein2.5 μM2.1 μM
Testis11.5 nmoles progesterone/h × mg⁻¹ protein0.27 μM0.74 μM
Ovary1.9 nmoles progesterone/h × mg⁻¹ protein0.16 μM0.13 μM

The adrenal microsomes show significantly higher enzymatic activity compared to other tissues. These rate measurements are consistent with the apparent potentials of these organs to synthesize their characteristic hormones, suggesting that 3β-HSDH activity may be an important rate-determining step in hormone synthesis . Interestingly, in some tissues, substrate inhibition has been noted, though the importance of this substrate inhibition in progesterone formation remains to be fully assessed .

What are the recommended methods for cloning and expressing recombinant macaque HSD3B1?

For successful cloning and expression of recombinant Macaca mulatta HSD3B1, researchers should consider the following methodological approach:

  • cDNA Library Screening: Start by screening a rhesus monkey tissue cDNA library (such as ovary λgt11 cDNA library) using a human HSD3B1 cDNA probe under high stringency conditions .

  • Expression Vector Construction: Clone the full-length HSD3B1 cDNA into an appropriate expression vector containing a strong promoter. For mammalian expression, vectors with CMV promoters are frequently used.

  • Host Cell Selection: COS-1 cells (monkey transformed kidney cells) have proven effective for expressing recombinant HSD3B1 and are preferred when functional activity needs to be assessed .

  • Transfection and Expression Monitoring:

    • Co-transfect with a β-galactosidase expression vector to normalize for transfection efficiency

    • Monitor expression through Western blot analysis using anti-His antibodies (if a His-tag was incorporated)

    • Validate expression through quantitative RT-PCR for mRNA levels

  • Protein Purification: For studies requiring purified protein, affinity chromatography using the incorporated tag (His, GST, etc.) is recommended, followed by size exclusion chromatography to ensure purity.

  • Activity Verification: Enzymatic activity can be evaluated by measuring the conversion of [³H]-pregnenolone to [³H]progesterone using thin-layer chromatography or HPLC methods .

What are the critical factors affecting recombinant HSD3B1 activity in experimental systems?

Several critical factors can significantly impact the activity of recombinant macaque HSD3B1 in experimental systems:

  • Enzyme Stability and Degradation: Research has shown that certain polymorphisms can affect protein stability. For optimal activity, preventing enzyme degradation is crucial. In vitro translation and degradation assays using rabbit reticulocyte lysate systems can help assess stability factors .

  • Cofactor Availability: HSD3B1 can use either NAD⁺/NADH or NADP⁺/NADPH as cofactors, with certain preferences depending on the specific reaction. Ensuring adequate cofactor availability is essential for optimal activity .

  • Membrane Association: As HSD3B1 is an integral membrane protein with multiple membrane-spanning segments, the lipid environment can significantly impact enzyme activity. Expression systems that maintain appropriate membrane composition will yield better functional results .

  • Oxygen Levels: Studies with primate cells and tissues have shown that physiological oxygen levels (5% O₂) rather than atmospheric levels (20% O₂) can be beneficial for maintaining cellular function in steroidogenic contexts .

  • Substrate Inhibition: Evidence indicates that substrate inhibition can occur in some tissues, which may affect experimental results. Careful titration of substrate concentrations is advisable to optimize enzymatic activity .

  • Post-translational Modifications: Proper post-translational modifications, which might differ between expression systems, can affect enzyme activity and stability. Mammalian cell lines like COS-1 are preferred for maintaining physiologically relevant modifications .

How does rhesus macaque HSD3B1 compare to human HSD3B1 in terms of structure, function, and genetics?

Structural Similarities and Differences:

  • Macaque HSD3B1 consists of 372 amino acids, while human HSD3B1 contains 373 amino acids

  • The proteins share 93.9% amino acid sequence similarity

  • Both enzymes contain membrane-spanning domains with similar predicted topologies

  • The nucleotide sequence of macaque HSD3B1 cDNA is 1629 bp, encoding a protein with a calculated molecular mass of 41,874 Daltons (excluding the first Met)

Functional Comparison:

  • Both enzymes catalyze the same key reactions in steroid biosynthesis, converting pregnenolone to progesterone, 17α-hydroxypregnenolone to 17α-hydroxyprogesterone, and DHEA to androstenedione

  • Kinetic parameters may differ between species, potentially affecting substrate affinities and reaction rates

  • Both use NAD⁺/NADH or NADP⁺/NADPH as cofactors, though preferences may vary by reaction and tissue context

Genetic Aspects:

  • The human HSD3B1 gene maps to chromosome 1p11-12

  • The human gene contains 4 exons spanning approximately 8.1 kb

  • While the human HSD3B1(1245A>C) polymorphism (rs1047303) has been extensively studied for its clinical significance in prostate cancer, equivalent polymorphisms in macaque HSD3B1 require further investigation

This high degree of similarity makes the rhesus macaque an excellent model for studying human steroid metabolism, particularly in contexts where human tissue experimentation is limited by ethical considerations.

What are the limitations of using macaque HSD3B1 as a model for human steroid metabolism?

Despite the high degree of similarity between macaque and human HSD3B1, several important limitations should be considered when using macaque HSD3B1 as a model for human steroid metabolism:

  • Species-Specific Regulation: While the enzymes share high sequence homology, regulatory mechanisms may differ. The 5'-flanking regions of these genes show cell line-dependent variation in their ability to drive transcription, which might not translate directly between species .

  • Polymorphism Differences: The clinically significant HSD3B1(1245A>C) polymorphism in humans (which affects prostate cancer outcomes) may not have an exact equivalent in macaques, limiting direct translational studies of this particular genetic variant .

  • Enzyme Kinetics Variances: Studies suggest differences in enzyme kinetics between species. For example, research has shown species differences in the regulation of CYP11A activity between postnatal rats and mice based on studies using cultured Leydig cells . Similar species-specific differences might exist for HSD3B1.

  • Tissue Distribution Variations: Though both species express HSD3B1 in classical steroidogenic and peripheral tissues, the relative expression levels and precise distribution patterns may differ, affecting the applicability of tissue-specific findings .

  • Hormonal Regulation Differences: The response to hormonal regulation might vary between species. Studies of cultured rat and mouse Leydig cells showed different responses to cAMP: in mouse cells, cAMP stimulates testosterone production which then suppresses 3β-HSD mRNA, whereas in rat cells, LH or cAMP increases 3β-HSD mRNA, protein, and activity .

  • Developmental Differences: The cellular expression of steroidogenic enzymes during development may follow different patterns between species, as observed with 17β-HSD in mouse studies .

These limitations underscore the importance of cautious interpretation when extrapolating findings from macaque models to human applications.

How do genetic variations in macaque HSD3B1 compare to the clinically significant HSD3B1(1245A>C) polymorphism in humans?

Human HSD3B1(1245A>C) Polymorphism:

  • This single nucleotide polymorphism (SNP; rs1047303) changes amino acid 367N→T in the human enzyme

  • The variant allele HSD3B1(1245C) renders the enzyme resistant to proteasomal degradation, causing increased intratumoral conversion of adrenal precursors to more potent androgens

  • Allelic frequency is 15-35% in most human cohorts, with variation by ethnicity (lower among Asians, higher among Caucasians)

  • Clinical studies have identified this variant as "adrenal-permissive" versus the wild-type "adrenal-restrictive" form

Macaque HSD3B1 Variations:

  • Comprehensive studies of polymorphic variants in macaque HSD3B1 equivalent to the human HSD3B1(1245A>C) are currently lacking in the literature

  • Given the 93.9% amino acid sequence similarity between human and macaque HSD3B1 , it's plausible that functionally similar variants might exist

  • No studies have yet established whether macaques possess genetic variations that affect enzyme stability and function in a manner similar to the human polymorphism

Research Implications:
This knowledge gap represents an important research opportunity. Identifying and characterizing analogous genetic variations in macaque HSD3B1 could:

  • Establish better translational models for studying prostate cancer drug resistance

  • Provide evolutionary insights into the conservation of functional genetic variations

  • Enable preclinical testing of targeted therapies for patients with specific HSD3B1 genotypes

Researchers interested in this area should consider sequencing HSD3B1 from diverse macaque populations to identify potential polymorphisms and then conduct functional studies to determine their impact on enzyme stability and activity.

What are the advanced techniques for studying the functional impact of HSD3B1 genetic variations?

Researchers studying the functional impact of HSD3B1 genetic variations can employ several advanced techniques:

  • CRISPR/Cas9 Gene Editing for Variant Models:

    • Create isogenic cell lines differing only in the HSD3B1 variant of interest

    • Generate knock-in animal models expressing specific variants

    • Develop organoid systems harboring different HSD3B1 genotypes

  • Protein Stability and Degradation Assays:

    • In vitro translation and degradation studies using rabbit reticulocyte lysate systems

    • Pulse-chase experiments with cycloheximide to measure protein half-life

    • Ubiquitination assays to quantify proteasomal targeting

    • Fluorescence resonance energy transfer (FRET)-based assays to monitor protein-protein interactions affecting stability

  • Advanced Enzymatic Activity Measurements:

    • LC-MS/MS-based steroid profiling to simultaneously measure multiple steroid metabolites

    • Microfluidic enzyme assays for high-throughput comparative studies

    • Isotope-labeled substrate tracing to measure flux through steroid pathways

    • In situ activity measurements in tissue sections to assess contextual enzyme function

  • Structural Biology Approaches:

    • X-ray crystallography or cryo-EM to determine how variants affect protein structure

    • Molecular dynamics simulations to predict functional consequences of amino acid substitutions

    • Hydrogen-deuterium exchange mass spectrometry to identify regions of altered protein dynamics

  • Genomic and Transcriptomic Analysis:

    • ChIP-seq to study transcription factor binding at the HSD3B1 promoter and enhancers

    • ATAC-seq to assess chromatin accessibility around variant alleles

    • RNA-seq to identify differentially expressed genes associated with HSD3B1 variants

    • Single-cell sequencing to characterize cell-type specific effects of variants

  • Translational Models:

    • Patient-derived xenografts with defined HSD3B1 genotypes

    • Ex vivo culture of primary tissues from individuals with different genotypes

    • Development of humanized animal models expressing human HSD3B1 variants

These advanced techniques provide comprehensive insights into how genetic variations impact HSD3B1 function across molecular, cellular, and physiological levels.

How is macaque HSD3B1 utilized in modeling prostate cancer resistance to androgen deprivation therapy?

Macaque HSD3B1 serves as a valuable tool for modeling prostate cancer resistance to androgen deprivation therapy (ADT), though most clinical applications have primarily focused on the human enzyme. The research approach can be adapted to macaque models as follows:

  • Mechanistic Studies of ADT Resistance:
    The HSD3B1 enzyme is central to understanding ADT resistance because it catalyzes a rate-limiting step in the conversion of adrenal androgen precursors to potent androgens like dihydrotestosterone (DHT) . While human studies have shown that the adrenal-permissive HSD3B1(1245C) allele confers resistance to ADT through increased androgen synthesis , macaque models can be used to study this mechanism in a controlled experimental setting.

  • Preclinical Drug Testing:
    Recombinant macaque HSD3B1 can be used to test novel inhibitors targeting this enzyme. Such inhibitors could potentially overcome resistance to conventional ADT. Recent research has highlighted that "therapeutic targeting through 3β-HSD1 inhibition and other therapies targeting the androgen-receptor axis" may be valuable approaches .

  • Radiotherapy Resistance Modeling:
    Recent studies have established a link between HSD3B1 genotype and resistance to combined radiotherapy and hormone therapy. Research found that "even low-level testosterone production in the tumor itself, and presumably the region around the tumor, appeared to drive a robust resistance to radiotherapy" which was associated with enhanced DNA damage repair capacity in cells expressing the adrenal-permissive subtype . Macaque models can help elucidate this mechanism.

  • Combination Therapy Studies:
    Macaque models can be used to evaluate the effectiveness of combination therapies. For instance, research has shown that resistance to radiotherapy associated with certain HSD3B1 variants "was reversible by treatment with direct androgen receptor targeting therapy with an ARSI (androgen receptor selective inhibitor)" . These findings can guide clinical decision-making for patients with different HSD3B1 genotypes.

  • Biomarker Development:
    By understanding the parallels between macaque and human HSD3B1, researchers can develop and validate biomarkers for predicting therapy response. The HSD3B1 genotype itself has emerged as "a potential predictive biomarker that may aid clinicians in determining up front whether a patient with prostate cancer may benefit from intensified hormone therapy combinations" .

These applications demonstrate how macaque HSD3B1 research contributes to advancing our understanding of prostate cancer treatment resistance and developing targeted therapeutic strategies.

Beyond prostate cancer, what other disease models benefit from research on macaque HSD3B1?

Research on macaque HSD3B1 extends beyond prostate cancer to several other disease models, offering valuable insights into various pathophysiological conditions:

  • Asthma and Glucocorticoid Resistance:
    Recent research has identified a significant connection between HSD3B1 genotype and glucocorticoid responsiveness in asthma. Studies revealed that "the adrenal restrictive HSD3B1(1245) genotype is associated with GC resistance" in severe asthma . This represents "the first genetic evidence to our knowledge that implicates an androgen synthesis variant in resistance to glucocorticoids for asthma or any other inflammatory disease" . Macaque models can help elucidate these mechanisms.

  • Fertility and Reproductive Disorders:
    HSD3B1 plays a crucial role in steroid hormone biosynthesis essential for reproductive function. Studies in macaques have shown that "3β-HSDH activity may be an important rate determining step in hormone synthesis" , suggesting its potential role in fertility disorders. Macaque follicular development and oocyte maturation studies indicate that this enzyme is crucial for normal ovarian function .

  • Benign Prostatic Hyperplasia (BPH):
    Studies involving red maca (Lepidium meyenii) and its effects on BPH have shown interactions with steroidogenic pathways including those involving 3β-hydroxysteroid dehydrogenase . Macaque models of HSD3B1 function can help understand the mechanisms behind BPH development and potential phytotherapeutic interventions.

  • Adrenal Disorders:
    Given that macaque adrenal microsomes show significantly higher HSD3B1 enzymatic activity compared to other tissues , macaque models are particularly valuable for studying adrenal disorders involving steroid hormone imbalances.

  • Developmental and Aging Research:
    Studies have shown that the survival rate of follicles during 3D culture decreases for those from older adult animals compared to young or prepubertal monkeys , suggesting age-related changes in steroidogenic function. Macaque HSD3B1 research can provide insights into age-related changes in steroid metabolism.

  • Pharmacogenetic Applications:
    Understanding species-specific differences in HSD3B1 function can inform drug development and dosing strategies. For instance, knowledge that "3β-HSD1 impairs enzalutamide action through enhanced steroidogenesis of potent androgens in addition to promoting metabolism of abiraterone and reducing drug concentration and effectiveness" has important implications for personalized medicine approaches.

These diverse applications demonstrate the broad significance of macaque HSD3B1 research across multiple disease areas and therapeutic domains.

What are the optimal conditions for measuring enzymatic activity of recombinant macaque HSD3B1?

Establishing optimal conditions for measuring enzymatic activity of recombinant macaque HSD3B1 requires careful consideration of multiple factors:

Buffer and pH Conditions:

  • Phosphate buffer (50-100 mM) at pH 7.4 is typically used for initial characterization

  • Test pH range of 6.5-8.0 to determine the enzyme's pH optimum

  • Include stabilizing agents such as glycerol (10-20%) to maintain enzyme integrity

Cofactor Requirements:

  • HSD3B1 can utilize both NAD⁺/NADH and NADP⁺/NADPH as cofactors

  • For dehydrogenase activity, provide NAD⁺ (1-2 mM)

  • For reductase activity, provide NADPH (1-2 mM)

  • Determine cofactor preference by comparing reaction rates with each

Substrate Considerations:

  • Optimal pregnenolone concentration ranges from 0.5-5 μM based on the known Km values (0.16-2.5 μM across different tissues)

  • Be aware of potential substrate inhibition, which has been observed in certain tissues

  • For accurate kinetic measurements, use tritium-labeled substrates (e.g., [³H]-pregnenolone) to track conversion to [³H]progesterone

Assay Conditions:

  • Temperature: 37°C (physiological) is standard

  • Reaction time: Establish linearity by sampling multiple time points (5-60 minutes)

  • Protein concentration: Titrate to ensure reaction is in linear range (typically 1-50 μg protein per reaction)

  • Include protease inhibitors (e.g., PMSF, leupeptin, aprotinin) to prevent enzyme degradation

Detection Methods:

  • HPLC with radioactivity detection for labeled substrates

  • LC-MS/MS for unlabeled substrates and comprehensive metabolite profiling

  • Thin-layer chromatography for basic activity measurements

  • Spectrophotometric assays monitoring NAD⁺/NADP⁺ reduction at 340 nm

Membrane Environment:

  • Since HSD3B1 is an integral membrane protein, consider including phospholipids or detergents to mimic membrane environment

  • Test different detergents (e.g., Triton X-100, CHAPS) at concentrations below critical micelle concentration

  • Alternatively, use microsomal preparations that maintain the native membrane environment

Controls:

  • Include heat-inactivated enzyme as negative control

  • Use purified human HSD3B1 for comparative analysis

  • Include control reactions without substrate or without cofactor

By systematically optimizing these conditions, researchers can establish reliable assays for measuring macaque HSD3B1 activity for various experimental applications.

What are the challenges in studying tissue-specific expression and regulation of HSD3B1 in macaque models?

Studying tissue-specific expression and regulation of HSD3B1 in macaque models presents several significant challenges that researchers must address:

  • Tissue Access and Ethical Considerations:

    • Limited availability of diverse macaque tissues due to ethical constraints

    • Need for approved protocols for tissue collection that balance research needs with animal welfare

    • Requirement for maximizing data obtained from each sample through multi-omics approaches

  • Cellular Heterogeneity Within Tissues:

    • Steroidogenic tissues contain multiple cell types with different HSD3B1 expression profiles

    • Standard bulk tissue analysis obscures cell-specific expression patterns

    • Need for single-cell approaches or careful microdissection to resolve cellular heterogeneity

  • Developmental and Hormonal Variation:

    • HSD3B1 expression varies with developmental stage, age, and hormonal status

    • Factors such as menstrual cycle in females significantly affect expression patterns

    • Studies have shown survival rate differences in follicles from prepubertal (1-3 years), young adult (4-11 years), and older adult (13-16 years) monkeys

  • Methodological Challenges:

    • RNA preservation in tissue samples can be problematic, especially in lipid-rich steroidogenic tissues

    • Cross-reactivity of antibodies between closely related enzymes (HSD3B1 vs. HSD3B2)

    • Need for validated rhesus-specific reagents (primers, antibodies) that may not be commercially available

  • Complex Transcriptional Regulation:

    • Tissue-specific promoters and enhancers remain poorly characterized in macaques

    • Common variant haplotypes in the 5′-flanking regions show significant cell line-dependent variation in their ability to drive transcription

    • Multiple transcription factors (including SF1) regulate expression in complex patterns

  • Post-transcriptional Regulation:

    • mRNA levels may not correlate with protein abundance or enzymatic activity

    • Post-translational modifications affecting enzyme function are tissue-specific

    • Protein turnover rates vary across tissues and physiological states

  • Ex Vivo Culture Challenges:

    • Maintaining tissue-specific phenotypes in culture is difficult

    • Oxygen levels significantly impact cell function (5% O₂ is more beneficial than 20% O₂)

    • Need for appropriate extracellular matrix components to maintain cellular architecture

  • Translational Relevance Assessment:

    • Determining how macaque tissue-specific patterns translate to human physiology

    • Species differences in regulatory mechanisms may limit direct extrapolation

    • Validating findings requires parallel studies in human tissues when available

Addressing these challenges requires interdisciplinary approaches combining advanced molecular techniques, careful experimental design, and innovative analytical methods to fully characterize the tissue-specific expression and regulation of HSD3B1 in macaque models.

What emerging technologies could advance the study of macaque HSD3B1 and its role in steroid metabolism?

Several emerging technologies hold promise for significantly advancing the study of macaque HSD3B1 and its role in steroid metabolism:

These emerging technologies, especially when used in combination, will provide unprecedented insights into HSD3B1 function and regulation, potentially leading to novel therapeutic strategies for disorders involving steroid metabolism.

How might research on macaque HSD3B1 inform personalized medicine approaches in humans?

Research on macaque HSD3B1 has significant potential to inform personalized medicine approaches in humans, particularly in the context of diseases involving steroid metabolism:

  • Genotype-Guided Therapy Selection:
    Human studies have already established that the HSD3B1 genotype can predict response to therapy in prostate cancer. For instance, individuals with the adrenal-permissive HSD3B1(1245C) allele show resistance to conventional androgen deprivation therapy (ADT) . Macaque models that recapitulate these genetic variants can provide controlled experimental systems to test alternative treatment strategies for different genotypes, ultimately informing human therapeutic decisions.

  • Biomarker Development and Validation:
    Macaque models enable the discovery and validation of biomarkers associated with HSD3B1 function and steroid metabolism. Research has shown that "adrenal-permissive HSD3B1 inheritance is associated with increased risk of death in men starting long-term hormone therapy" , indicating the potential of HSD3B1 genotype as a prognostic biomarker. Advanced studies in macaques can help identify additional biomarkers that might further refine risk stratification.

  • Drug Development for Resistant Phenotypes:
    Studies have demonstrated that "resistance was reversible by treatment with direct androgen receptor targeting therapy with an ARSI (androgen receptor selective inhibitor)" . Macaque models provide platforms for testing novel HSD3B1 inhibitors or combination therapies specifically designed for individuals with resistant genotypes, accelerating drug development for these challenging cases.

  • Predicting Treatment Side Effects:
    Different HSD3B1 genotypes may not only affect treatment efficacy but also susceptibility to side effects. Macaque studies can help characterize these differences, allowing clinicians to anticipate and mitigate adverse effects in a genotype-specific manner.

  • Expanded Applications Beyond Cancer:
    The finding that "the adrenal restrictive HSD3B1(1245) genotype is associated with GC resistance" in asthma suggests that HSD3B1 genotyping could inform treatment decisions in inflammatory conditions. Macaque models can help identify additional disease contexts where HSD3B1 genotype affects treatment response.

  • Therapeutic Window Optimization:
    Tissue-specific differences in HSD3B1 activity observed in macaques suggest that optimal drug dosing may vary based on an individual's genotype and the specific tissue being targeted. This knowledge could inform personalized dosing strategies that maximize efficacy while minimizing side effects.

  • Integration with Multi-Omic Data:
    Combining HSD3B1 genotype with other molecular markers (transcriptomic, proteomic, metabolomic) in macaque models can establish patterns that predict treatment response more accurately than single markers. These integrated approaches can then be translated to human clinical applications.

  • Non-Invasive Monitoring Strategies:
    Macaque research can help develop non-invasive methods to monitor HSD3B1 activity through circulating steroid metabolites, potentially enabling real-time assessment of treatment efficacy and disease progression in patients with different genotypes.

By bridging basic mechanistic understanding with clinical applications, macaque HSD3B1 research provides a crucial translational platform for advancing personalized medicine approaches in human diseases involving steroid metabolism.

What are common challenges in purifying active recombinant macaque HSD3B1 and how can they be addressed?

Purifying active recombinant macaque HSD3B1 presents several challenges due to its nature as a membrane-associated enzyme. Here are the common issues and recommended solutions:

  • Poor Expression Levels:

    Challenge: Membrane proteins like HSD3B1 often express at lower levels than soluble proteins.

    Solutions:

    • Optimize codon usage for the expression system being used

    • Test different promoters (T7, CMV, EF1α) to identify optimal expression levels

    • Use specialized expression strains designed for membrane proteins

    • Consider fusion tags that enhance expression (e.g., SUMO, MBP)

    • Implement temperature control during expression (lower temperatures may improve folding)

  • Membrane Association and Solubilization:

    Challenge: As an integral membrane protein with multiple membrane-spanning segments , HSD3B1 requires detergents for solubilization.

    Solutions:

    • Screen multiple detergents (DDM, CHAPS, Triton X-100) at various concentrations

    • Consider mild detergents that maintain protein structure and activity

    • Test detergent mixtures which sometimes perform better than single detergents

    • Add lipids during purification to stabilize the protein

    • Use styrene maleic acid (SMA) copolymers to extract proteins with their native lipid environment

  • Protein Aggregation:

    Challenge: Membrane proteins are prone to aggregation during purification.

    Solutions:

    • Add glycerol (10-20%) to all buffers to prevent aggregation

    • Include reducing agents (DTT, β-mercaptoethanol) to prevent disulfide-mediated aggregation

    • Maintain protein concentrations below the aggregation threshold

    • Use size exclusion chromatography as a final purification step to remove aggregates

    • Consider amphipathic polymers or nanodiscs for stabilization

  • Low Enzymatic Activity:

    Challenge: Purified HSD3B1 often shows reduced activity compared to cellular contexts.

    Solutions:

    • Ensure cofactor availability (NAD⁺/NADH or NADP⁺/NADPH) during and after purification

    • Reconstitute purified enzyme in liposomes to restore membrane environment

    • Test different lipid compositions to optimize activity

    • Add stabilizing agents like trehalose or sucrose

    • Minimize freeze-thaw cycles which can reduce activity

  • Protein Degradation:

    Challenge: HSD3B1 may be susceptible to proteolytic degradation during purification.

    Solutions:

    • Include protease inhibitor cocktails in all buffers

    • Perform purification at 4°C to minimize proteolytic activity

    • Use freshly prepared reagents to minimize contamination

    • Consider fast purification protocols to reduce exposure time

    • If using His-tag purification, add imidazole to washing buffers to reduce non-specific binding of proteases

  • Purity Assessment:

    Challenge: Traditional methods may not accurately assess membrane protein purity.

    Solutions:

    • Combine SDS-PAGE with Western blotting using HSD3B1-specific antibodies

    • Use analytical size exclusion chromatography to assess homogeneity

    • Implement negative stain electron microscopy to visualize protein quality

    • Perform mass spectrometry to identify contaminants

    • Use enzymatic assays to correlate protein concentration with activity

By systematically addressing these challenges, researchers can improve the yield and quality of purified recombinant macaque HSD3B1, enabling more detailed structural and functional studies of this important enzyme.

How can researchers troubleshoot inconsistent results in HSD3B1 activity assays across different experimental systems?

Inconsistent results in HSD3B1 activity assays across different experimental systems are a common challenge. Here's a comprehensive troubleshooting guide:

  • Expression System Variations:

    Issue: Different expression systems (bacterial, yeast, insect, mammalian) may produce enzyme with varying post-translational modifications and folding.

    Troubleshooting Approach:

    • Compare activity of HSD3B1 expressed in different systems using identical assay conditions

    • Validate with Western blots to confirm consistent protein expression levels

    • Consider using COS-1 cells (monkey kidney cells) which support proper folding of primate proteins

    • Document the expression system used and avoid comparing results across different systems directly

  • Cofactor Considerations:

    Issue: HSD3B1 can utilize both NAD⁺/NADH and NADP⁺/NADPH as cofactors, with preferences potentially varying by reaction direction and experimental conditions.

    Troubleshooting Approach:

    • Test both cofactor systems in parallel assays

    • Ensure fresh preparation of cofactors (they can degrade during storage)

    • Titrate cofactor concentrations to determine optimal levels

    • Check pH of cofactor solutions as acidic conditions can affect NAD(P)⁺ stability

  • Membrane Environment Effects:

    Issue: HSD3B1 is an integral membrane protein, and its activity is influenced by the lipid environment.

    Troubleshooting Approach:

    • For cell-based assays, document cell confluence and passage number

    • For enzyme preparations, standardize detergent type and concentration

    • Consider adding phospholipids to purified enzyme preparations

    • Compare microsomal fractions versus purified enzyme to assess membrane environment effects

  • Substrate Inhibition Phenomena:

    Issue: Studies have noted substrate inhibition in some tissues , which can lead to non-linear kinetics and inconsistent results.

    Troubleshooting Approach:

    • Perform substrate titrations to identify optimal concentration ranges

    • Generate complete kinetic curves rather than single-point measurements

    • Use Michaelis-Menten or substrate inhibition models as appropriate for data analysis

    • Document substrate storage conditions and preparation methods

  • Assay Detection Method Variability:

    Issue: Different detection methods (radiometric, HPLC, LC-MS/MS, spectrophotometric) have varying sensitivities and specificity.

    Troubleshooting Approach:

    • Include internal standards for quantitative methods

    • Validate new detection methods against established protocols

    • Ensure linear range of detection is established for each method

    • Consider matrix effects in complex biological samples

  • Tissue-Specific Factors:

    Issue: HSD3B1 activity varies significantly across tissues (adrenal microsomes show significantly higher activity than other tissues) .

    Troubleshooting Approach:

    • Document tissue source and preparation method in detail

    • Compare results only within the same tissue type

    • Consider tissue-specific cofactors or modulators that may be present in crude preparations

    • Adjust assay conditions based on known tissue-specific kinetic parameters

  • Oxygen and Temperature Sensitivity:

    Issue: Enzymatic activity can be affected by oxygen levels and temperature fluctuations.

    Troubleshooting Approach:

    • Control oxygen levels during assays (5% O₂ may be more physiologically relevant than 20% O₂)

    • Maintain consistent temperature throughout assay procedures

    • Document any temperature cycling during sample processing

    • Consider adding antioxidants to reaction mixtures

  • Systematic Validation Approach:

    When facing inconsistent results, implement a systematic validation process:

    • Run positive and negative controls with each assay

    • Perform parallel assays with commercial enzyme preparations when available

    • Establish a reference standard operating procedure (SOP) in your laboratory

    • Implement quality control metrics (Z'-factor, signal-to-background ratio)

    • Consider round-robin testing between different laboratory members or collaborators

By methodically addressing these factors, researchers can identify sources of variability, improve reproducibility, and generate more consistent and reliable data from HSD3B1 activity assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.